PCF11 Antibody (3G4), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00051585-M04

Product Code. 18389749

Description

PCF11 Monoclonal antibody specifically detects PCF11 in Human samples. It is validated for Western Blot, ELISA, ELISA

Specifications

• Antigen: PCF11
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene Accession No.: NP_056969
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51585
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ

• Applications: Western Blot, ELISA, Sandwich ELISA
• Clone: 3G4
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: KIAA0824PCF11p homolog, PCF11, cleavage and polyadenylation factor II subunit, homolog, PCF11, cleavage and polyadenylation factor II subunit, homolog (S. cerevisiae), PCF11, cleavage and polyadenylation factor subunit, homolog (S. cerevisiae), pre-mRNA cleavage complex 2 protein Pcf11, Pre-mRNA cleavage complex II protein Pcf11
• Immunogen: PCF11 (NP_056969.2, 1465 a.a. ~ 1555 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVENPLNIMLNIVKNELQEPCDSPKVKEERIDTPPACTEESIATPSEIKTENDTVESV
• Quantity: 0.1 mg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified