missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PCDHA10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PCDHA10 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PCDHA10 Polyclonal specifically detects PCDHA10 in Human samples. It is validated for Western Blot.Specifications
| PCDHA10 | |
| Polyclonal | |
| Rabbit | |
| A1L493 | |
| 56139 | |
| Synthetic peptides corresponding to PCDHA10(protocadherin alpha 10) The peptide sequence was selected from the N terminal of PCDHA10. Peptide sequence DKDKFPVLVLRKLLDREENPQLKLLLTATDGGKPEFTGSVSLLILVLDAN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CNR8, CNRN8, CNRS8, CRNR8, KIAA0345-like 4, ortholog to mouse CNR8, PCDH-alpha-10, PCDH-ALPHA10, protocadherin alpha 10, protocadherin alpha-10 | |
| PCDHA10 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title