missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PCDH11 Rabbit anti-Human, Polyclonal, Novus Biologicals™

PCDH11 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18398416 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18398416 100 μg 100µL
18343502 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18398416 Supplier Novus Biologicals Supplier No. NBP317750100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PCDH11 Polyclonal antibody specifically detects PCDH11 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen PCDH11
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias PCDH11, PCDH11Y, PCDH22, PCDH-PC, PCDHX, PCDH-X, PCDHY, PCDH-Y, protein phosphatase 1, regulatory subunit 119, protocadherin 11X, protocadherin 22, Protocadherin on the X chromosome, Protocadherin on the Y chromosome, Protocadherin prostate cancer, protocadherin-11 X-linked, Protocadherin-11 Y-linked, Protocadherin-22, protocadherin-PC, Protocadherin-S
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: PVSVHTRPPMKEVVRSCTPMKESTTMEIWIHPQPQRKSEGKVAGKSQRRVTF
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27328
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.