missing translation for 'onlineSavingsMsg'
Learn More

PAX9 Antibody (4B9), Novus Biologicals™

Product Code. 18377998 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18377998 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18377998 Supplier Novus Biologicals Supplier No. H00005083M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

PAX9 Monoclonal antibody specifically detects PAX9 in Human, Rat samples. It is validated for Western Blot, ELISA, KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen PAX9
Applications Western Blot, ELISA, KnockDown
Classification Monoclonal
Clone 4B9
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Knockdown Validated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_006185
Gene Alias paired box 9, paired box gene 9, paired box protein Pax-9, paired domain gene 9, STHAG3
Host Species Mouse
Immunogen PAX9 (NP_006185, 205 a.a. ~ 300 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 5083
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.