missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Pax3 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Pax3 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Product Code. 18372295 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18372295 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18372295 Supplier Novus Biologicals Supplier No. NBP310955100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Pax3 Polyclonal specifically detects Pax3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Pax3
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Formulation PBS buffer, 2% sucrose
Gene Alias CDHS, HuP2, HUP2MGC120384, MGC120381, MGC120382, MGC120383, MGC134778, paired box 3, paired box gene 3 (Waardenburg syndrome 1), paired box homeotic gene 3, paired box protein Pax-3, paired domain gene 3, paired domain gene HuP2, Waardenburg syndrome 1, WS1, WS3
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human Pax3 (NP_852122). Peptide sequence GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis, Mesenchymal Stem Cell Markers, Stem Cell Markers, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 5077
Target Species Human, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.