missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAWR/PAR4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38026-20ul
This item is not returnable.
View return policy
Description
PAWR /PAR4 Polyclonal antibody specifically detects PAWR /PAR4 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| PAWR /PAR4 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| Par-4, PAR4prostate apoptosis response protein 4, PRKC apoptosis WT1 regulator protein, PRKC, apoptosis, WT1, regulator, Prostate apoptosis response 4 protein, prostate apoptosis response protein PAR-4, transcriptional repressor PAR4, WT1-interacting protein | |
| A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAWR/PAR4 (NP_002574.2),, Sequence:, QNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMI | |
| 20 μL | |
| Apoptosis, Cancer, GPCR, Signal Transduction, Transcription Factors and Regulators, Tumor Suppressors | |
| 5074 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction