PATZ Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33488-20ul

Product Code. 30232588

Description

PATZ Monoclonal antibody specifically detects PATZ in Human samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: PATZ
• Classification: Monoclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: dJ400N23, MAZRPOZ-, AT hook-, and zinc finger-containing protein 1, PATZZinc finger and BTB domain-containing protein 19, POZ (BTB) and AT hook containing zinc finger 1, Protein kinase A RI subunit alpha-associated protein, RIAZBTB/POZ domain zinc finger transcription factor, ZBTB19BTB-POZ domain zinc finger transcription factor, Zinc finger protein 278Zinc finger sarcoma gene protein, ZNF278POZ-AT hook-zinc finger protein, ZSGMAZ-related factor
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human PATZ (NP_055138.2).,, Sequence:, PFPSVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSR
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23598
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG