PARP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49523-25ul

Product Code. 18694918

Description

PARP3 Polyclonal antibody specifically detects PARP3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: PARP3
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 3, ADPRT-3, ADPRT3PADPRT-3, ADPRTL2, ADPRTL3NAD+ ADP-ribosyltransferase 3, EC 2.4.2.30, hPARP-3, IRT1ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 2, NAD(+) ADP-ribosyltransferase 3, pADPRT-3, PARP-3, poly (ADP-ribose) polymerase family, member 3, poly [ADP-ribose] polymerase 3, poly(ADP-ribose) synthetase-3, Poly[ADP-ribose] synthase 3, poly[ADP-ribose] synthetase 3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LSKQQIARGFEALEALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEV
• Quantity: 25 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 10039
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified