missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PARP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | PARP2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232623
|
Novus Biologicals
NBP3-35672-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30230317
|
Novus Biologicals
NBP3-35672-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PARP2 Polyclonal antibody specifically detects PARP2 in Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| PARP2 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, DNA Repair, Hypoxia | |
| PBS (pH 7.3), 50% glycerol | |
| 10038 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| ADP-ribosyltransferase (NAD+; poly(ADP-ribose) polymerase)-like 2, ADPRT-2, ADPRT2pADPRT-2, ADPRTL2EC 2.4.2.30, ADPRTL3, hPARP-2, NAD(+) ADP-ribosyltransferase 2, PARP-2, poly (ADP-ribose) polymerase 2, poly (ADP-ribose) polymerase family, member 2, poly (ADP-ribosyl) transferase-like 2, poly [ADP-ribose] polymerase 2, poly(ADP-ribose) synthetase, Poly[ADP-ribose] synthase 2, poly[ADP-ribose] synthetase 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PARP2 (NP_001036083.1).,, Sequence:, FADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTLNYNEYIVYN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title