PARG Antibody, Novus Biologicals™

Artikelnummer.	Quantity	unitSize
18433131	25 μL	25µL
18740904	-	0.1mL

Artikelnummer. 18433131 Lieferant Novus Biologicals Lieferanten-Nr. NBP18945025ul

Beschreibung

Rabbit Polyclonal Antibody has been used in 1 publication

PARG Polyclonal specifically detects PARG in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Spezifikation

• Antigen: PARG
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 3.2.1.143, FLJ54459, FLJ60257, FLJ60456, PARG99, poly (ADP-ribose) glycohydrolase, poly(ADP-ribose) glycohydrolase, poly(ADP-ribose) glycohydrolase 60 kDa isoform
• Gene Symbols: PARG
• Host Species: Rabbit
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:WQRRCTEIVAIDALHFRRYLDQFVPEKMRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAA
• Purification Method: Affinity Purified
• Quantity: 25 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8505
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only