missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PARD6B Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10560-100UL
This item is not returnable.
View return policy
Description
PARD6B Polyclonal specifically detects PARD6B in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry.
Specifications
| PARD6B | |
| Polyclonal | |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| par-6 (partitioning defective 6, C.elegans) homolog beta, PAR-6 beta, par-6 partitioning defective 6 homolog beta (C. elegans), PAR6B, PAR-6B, partitioning defective 6 homolog beta | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE PARD6B (NP_067384). Peptide sequence SKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL | |
| 100 μg | |
| Cell Cycle and Replication | |
| 84612 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction