missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PARD6B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
£213.00 - £428.00
Specifications
| Antigen | PARD6B |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Chromatin Immunoprecipitation (ChIP) |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), ChIP Assay |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18425491
|
Novus Biologicals
NBP1-87337-25ul |
25 μL |
£213.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18040794
|
Novus Biologicals
NBP1-87337 |
0.1 mL |
£428.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PARD6B Polyclonal specifically detects PARD6B in Human, Mouse samples. It is validated for Chromatin Immunoprecipitation, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| PARD6B | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), ChIP Assay | |
| Unconjugated | |
| RUO | |
| Human | |
| par-6 (partitioning defective 6, C.elegans) homolog beta, PAR-6 beta, par-6 partitioning defective 6 homolog beta (C. elegans), PAR6B, PAR-6B, partitioning defective 6 homolog beta | |
| PARD6B | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Chromatin Immunoprecipitation (ChIP) | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 84612 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title