PARD6A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-38027-100ul

Product Code. 30228877

Description

PARD6A Polyclonal antibody specifically detects PARD6A in Human,Mouse samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: PARD6A
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA
• Gene Alias: PAR-6, PAR-6 alpha, par-6 partitioning defective 6 homolog alpha (C. elegans), PAR6A, PAR6alpha, PAR-6Apar-6 (partitioning defective 6, C.elegans) homolog alpha, PAR6C, partitioning defective 6 homolog alpha, partitioning defective-6 homolog alpha, partitioning-defective protein 6, Tax interaction protein 40, TAX40, Tax-interacting protein 40, TIP-40PAR6
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PARD6A (Q9NPB6).,, Sequence:, MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEADS
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 50855
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified