missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PAR2 Monoclonal antibody specifically detects PAR2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | PAR2 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | 9X8E6 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | coagulation factor II (thrombin) receptor-like 1, Coagulation factor II receptor-like 1, GPR11protease-activated receptor 2, G-protein coupled receptor 11, PAR-2, PAR2G protein-coupled receptor-11, proteinase-activated receptor 2, proteinase-activated receptor-2, Thrombin receptor-like 1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 298-397 of human PAR2 (P55085). ICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?