PAR2 Rabbit anti-Human, Mouse, Rat, Clone: 9X8E6, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-16555-20UL

Product Code. 18373684

Description

PAR2 Monoclonal antibody specifically detects PAR2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: PAR2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Clone: 9X8E6
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
• Gene Alias: coagulation factor II (thrombin) receptor-like 1, Coagulation factor II receptor-like 1, GPR11protease-activated receptor 2, G-protein coupled receptor 11, PAR-2, PAR2G protein-coupled receptor-11, proteinase-activated receptor 2, proteinase-activated receptor-2, Thrombin receptor-like 1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 298-397 of human PAR2 (P55085). ICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY
• Quantity: 20 μg
• Research Discipline: GPCR, Signal Transduction
• Gene ID (Entrez): 2150
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG