missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAQR6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PAQR6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PAQR6 Polyclonal specifically detects PAQR6 in Human samples. It is validated for Western Blot.Specifications
| PAQR6 | |
| Polyclonal | |
| Rabbit | |
| Q5TCK9 | |
| 79957 | |
| Synthetic peptides corresponding to PAQR6(progestin and adipoQ receptor family member VI) The peptide sequence was selected from the N terminal of PAQR6. Peptide sequence PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| progestin and adipoQ receptor family member 6, progestin and adipoQ receptor family member VIFLJ22672 | |
| PAQR6 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title