missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PAPSS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

PAPSS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18383197 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18383197 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18383197 Supplier Novus Biologicals Supplier No. NBP309946100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PAPSS2 Polyclonal specifically detects PAPSS2 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PAPSS2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias 3'-phosphoadenosine 5'-phosphosulfate synthase 2, ATP sulfurylase/adenosine 5'-phosphosulfate kinase, ATPSK2ATP sulfurylase/APS kinase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2, EC 2.7.1.25, PAPS synthase 2, PAPS synthetase 2, PAPSS 2, SK 2, SK2, Sulfurylase kinase 2,3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAPS2. Peptide sequence MIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPF
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 9060
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.