missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAPD5 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94332-0.02ml
This item is not returnable.
View return policy
Description
PAPD5 Polyclonal antibody specifically detects PAPD5 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| PAPD5 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| EC 2.7.7, EC 2.7.7.-, FLJ40270, PAP associated domain containing 5, Terminal uridylyltransferase 3, Topoisomerase-related function protein 4-2, TRF4-2PAP-associated domain-containing protein 5, TUTase 3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 480-590 of human PAPD5 (NP_001035374.2). YYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGNGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSESLSKHSSNSSSGPVSSSSATQSSSSDVDSDAT | |
| 0.02 mL | |
| Cancer | |
| 64282 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction