missing translation for 'onlineSavingsMsg'
Learn More

Pannexin-1 Rabbit anti-Human, Mouse, Rat, Clone: 7E8T3, Novus Biologicals™

Product Code. 18388351
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18388351 100 μg 100µL
18378146 20 μg 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18388351 Supplier Bio-Techne Supplier No. NBP316578100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Monoclonal Antibody

Pannexin-1 Monoclonal antibody specifically detects Pannexin-1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Pannexin-1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 7E8T3
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias MGC21309, MRS1innexin, pannexin 1, pannexin-1, PX1, UNQ2529
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 327-426 of human Pannexin-1 (Q96RD7). DLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 24145
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.