missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
PAMCI Polyclonal specifically detects PAMCI in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | PAMCI |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | PAM COOH-terminal interactor protein 1, PAMCI, PCIP1, P-CIP1peptidylglycine alpha-amidating monooxygenase COOH-terminal interactorprotein-1, Peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor, Ras association (RalGDS/AF-6) domain family (N-terminal) member 9, ras association domain-containing protein 9 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAMCI (NP_005438). Peptide sequence KEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?