missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAMCI Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-09529-100UL
This item is not returnable.
View return policy
Description
PAMCI Polyclonal specifically detects PAMCI in Human samples. It is validated for Western Blot.
Specifications
| PAMCI | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| PAM COOH-terminal interactor protein 1, PAMCI, PCIP1, P-CIP1peptidylglycine alpha-amidating monooxygenase COOH-terminal interactorprotein-1, Peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor, Ras association (RalGDS/AF-6) domain family (N-terminal) member 9, ras association domain-containing protein 9 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAMCI (NP_005438). Peptide sequence KEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDS | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 9182 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction