PALB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-38533-20ul

Artikelnummer. 30228854

Beschreibung

PALB2 Polyclonal antibody specifically detects PALB2 in Human samples. It is validated for ELISA,Western Blot

Spezifikation

• Antigen: PALB2
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA
• Gene Alias: DKFZp667I166, DKFZp686E1054, FANCNFLJ21816, partner and localizer of BRCA2, PNCA3
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 99-198 of human PALB2 (NP_078951.2).,, Sequence:, TLDVGPESFNPGDGPGGLPIQRTDDTQEHFPHRVSDPSGEQKQKLPSRRKKQQKRTFISQERDCVFGTDSLRLSGKRLKEQEEISSKNPARSPVTEIRTH
• Quantity: 20 μL
• Research Discipline: Breast Cancer, Cancer
• Gene ID (Entrez): 79728
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified