missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PAK1 interacting protein 1 Antibody, Novus Biologicals™

PAK1 interacting protein 1 Antibody, Novus Biologicals™

Product Code. 18611069 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18611069 25 μL 25µL
18631069 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18611069 Supplier Novus Biologicals Supplier No. NBP26861525ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PAK1 interacting protein 1 Polyclonal antibody specifically detects PAK1 interacting protein 1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen PAK1 interacting protein 1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias bA421M1.5, FLJ20624, hPIP1WD repeat-containing protein 84, MAK11, p21-activated protein kinase-interacting protein 1, PAK1 interacting protein 1, PIP1PAK/PLC-interacting protein 1, RP11-421M1.5, WDR84PAK1-interacting protein 1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GTITNEKRISSVKFLSESVLAVAGDEEVIRFFDCDSLVCLCEFKAHENRVKDMISFEIPEHHVIVSASSDGFIKMWK
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55003
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.