PAK1 interacting protein 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-90029-25ul

Product Code. 18417121

Description

PAK1 interacting protein 1 Polyclonal specifically detects PAK1 interacting protein 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PAK1 interacting protein 1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: bA421M1.5, FLJ20624, hPIP1WD repeat-containing protein 84, MAK11, p21-activated protein kinase-interacting protein 1, PAK1 interacting protein 1, PIP1PAK/PLC-interacting protein 1, RP11-421M1.5, WDR84PAK1-interacting protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55003
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PAK1IP1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VWLDKVADMKESLPPAAEPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTKKRGLTGDSKKATKES
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only