missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAIP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | PAIP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PAIP1 Polyclonal specifically detects PAIP1 in Human samples. It is validated for Western Blot.Specifications
| PAIP1 | |
| Polyclonal | |
| Rabbit | |
| Q9H074-2 | |
| 10605 | |
| Synthetic peptides corresponding to PAIP1(poly(A) binding protein interacting protein 1) The peptide sequence was selected from the N terminal of PAIP1. Peptide sequence MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MGC12360, PABC1-interacting protein 1, PABP-interacting protein 1, PAIP-1, poly(A) binding protein interacting protein 1, Poly(A)-binding protein-interacting protein 1, polyadenylate binding protein-interacting protein 1, polyadenylate-binding protein-interacting protein 1 | |
| PAIP1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title