PADI2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54958

Product Code. 18060094

Description

PADI2 Polyclonal specifically detects PADI2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PADI2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.5.3.15, KIAA0994PDI2PAD2, PAD-H19, peptidlyarginine deiminase type II, peptidyl arginine deiminase, type II, Peptidylarginine deiminase II, protein arginine deiminase, Protein-arginine deiminase type II, protein-arginine deiminase type-2
• Host Species: Rabbit
• Molecular Weight of Antigen: 75 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 83%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y2J8
• Gene Symbols: PADI2
• Immunogen: Synthetic peptides corresponding to PADI2(peptidyl arginine deiminase, type II) The peptide sequence was selected from the middle region of PADI2. Peptide sequence RGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11240
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only