missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PACRGL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PACRGL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PACRGL Polyclonal specifically detects PACRGL in Human samples. It is validated for Western Blot.Specifications
| PACRGL | |
| Polyclonal | |
| Rabbit | |
| C4orf28, chromosome 4 open reading frame 28, MGC29898, PACRG-like protein, PARK2 co-regulated-like | |
| PACRGL | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 133015 | |
| Synthetic peptides corresponding to C4ORF28 The peptide sequence was selected from the middle region of C4ORF28. Peptide sequence PPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title