missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PA28 Activator gamma Subunit/PSME3 Antibody, Novus Biologicals™

PA28 Activator gamma Subunit/PSME3 Antibody, Novus Biologicals™

Product Code. 18407320 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18407320 25 μL 25µL
18469720 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18407320 Supplier Novus Biologicals Supplier No. NBP18306325ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

PA28 Activator gamma Subunit/PSME3 Polyclonal antibody specifically detects PA28 Activator gamma Subunit/PSME3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen PA28 Activator gamma Subunit/PSME3
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias 11S regulator complex gamma subunit, 11S regulator complex subunit gamma, Activator of multicatalytic protease subunit 3, Ki, Ki antigen, PA28g, PA28gamma, PA28-gamma, PA28GKi nuclear autoantigen, proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki), Proteasome activator 28 subunit gamma, proteasome activator 28-gamma, proteasome activator complex subunit 3, REG-gamma
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: QEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNT
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Immune System Diseases, Immunology, Neuroscience, Stem Cell Markers, Ubiquitin Proteasome Pathway
Primary or Secondary Primary
Gene ID (Entrez) 10197
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.