missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18336598

PA28 Activator alpha Subunit/PSME1 Antibody, Novus Biologicals™

Product Code. 18336598 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18336598 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18336598 Supplier Novus Biologicals Supplier No. H00005720B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

PA28 Activator alpha Subunit/PSME1 Polyclonal antibody specifically detects PA28 Activator alpha Subunit/PSME1 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen PA28 Activator alpha Subunit/PSME1
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. AAH00352
Gene Alias 11S regulator complex alpha subunit, 11S regulator complex subunit alpha, 29-kD MCP activator subunit, IFI5111MGC8628, IGUP I-5111, Interferon gamma up-regulated I-5111 protein, interferon-gamma IEF SSP 5111, interferon-gamma-inducible protein 5111, PA28a, PA28alphaActivator of multicatalytic protease subunit 1, proteasome (prosome, macropain) activator subunit 1 (PA28 alpha), Proteasome activator 28 subunit alpha, proteasome activator complex subunit 1, proteasome activator subunit-1, REGalpha, REG-alpha
Host Species Mouse
Immunogen PSME1 (AAH00352, 1 a.a. - 249 a.a.) full-length human protein. MAMLRVQPEAQAKVDVFREDLCTKAENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 5720
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.