missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18393859

p97/VCP Antibody (2H5), Novus Biologicals™

Product Code. 18393859 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18393859 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18393859 Supplier Novus Biologicals Supplier No. H00007415M15

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

p97/VCP Monoclonal antibody specifically detects p97/VCP in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen p97/VCP
Applications Western Blot, ELISA, Immunocytochemistry
Classification Monoclonal
Clone 2H5
Conjugate Unconjugated
Dilution Western Blot 1:100 to 1:2000, ELISA, Immunocytochemistry/ Immunofluorescence 1:10 to 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH07562
Gene Alias 15S Mg(2+)-ATPase p97 subunit, IBMPFDMGC8560, MGC131997, p97, TER ATPase, TERA, transitional endoplasmic reticulum ATPase, valosin containing protein, Valosin-containing proteinMGC148092, yeast Cdc48p homolog
Host Species Mouse
Immunogen VCP (AAH07562.2, 221 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVP
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cellular Markers, DNA Repair, Membrane Trafficking and Chaperones, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 7415
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.