p97/VCP Antibody (2H5), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00007415-M15

Product Code. 18393859

Description

p97/VCP Monoclonal antibody specifically detects p97/VCP in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: p97/VCP
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: 15S Mg(2+)-ATPase p97 subunit, IBMPFDMGC8560, MGC131997, p97, TER ATPase, TERA, transitional endoplasmic reticulum ATPase, valosin containing protein, Valosin-containing proteinMGC148092, yeast Cdc48p homolog
• Immunogen: VCP (AAH07562.2, 221 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVP
• Quantity: 0.1 mg
• Research Discipline: Cellular Markers, DNA Repair, Membrane Trafficking and Chaperones, Signal Transduction
• Gene ID (Entrez): 7415
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ

• Applications: Western Blot, ELISA, Immunocytochemistry
• Clone: 2H5
• Dilution: Western Blot 1:100 to 1:2000, ELISA, Immunocytochemistry/ Immunofluorescence 1:10 to 1:500
• Gene Accession No.: AAH07562
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified