missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p70 S6 Kinase/S6K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38448
This item is not returnable.
View return policy
Description
p70 S6 Kinase/S6K Polyclonal specifically detects p70 S6 Kinase/S6K in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Specifications
| p70 S6 Kinase/S6K | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| P23443 | |
| RPS6KB1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISK | |
| 0.1 mL | |
| Autophagy, Cancer, mTOR Pathway, Protein Kinase, Signal Transduction | |
| 6198 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 2.7.11, EC 2.7.11.1, p70 ribosomal S6 kinase alpha, p70 S6 kinase alpha, p70 S6 kinase, alpha 1,70 kDa ribosomal protein S6 kinase 1, p70 S6 kinase, alpha 2, p70 S6KA, p70 S6K-alpha, p70(S6K)-alpha, p70-alpha, p70-S6K, P70S6K1, PS6K, ribosomal protein S6 kinase beta-1, Ribosomal protein S6 kinase I, ribosomal protein S6 kinase, 70kD, polypeptide 1, ribosomal protein S6 kinase, 70kDa, polypeptide 1, S6K, S6K1p70-S6K 1, S6K-beta-1, serine/threonine kinase 14 alpha, Serine/threonine-protein kinase 14A, STK14A | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction