missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. p66 alpha Antibody, Novus Biologicals™

p66 alpha Antibody, Novus Biologicals™

Product Code. 18414861 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18414861 25 μL 25µL
18296116 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18414861 Supplier Novus Biologicals Supplier No. NBP18735925ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 2 publications

p66 alpha Polyclonal specifically detects p66 alpha in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation (ChIP).
TRUSTED_SUSTAINABILITY

Specifications

Antigen p66 alpha
Applications ChIP Assay, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation
Classification Polyclonal
Concentration 0.1mg/mL
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunoprecipitation, Immunohistochemistry-Paraffin 1:20 - 1:50, Chromatin Immunoprecipitation (ChIP)
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q86YP4
Gene Alias FLJ20085, FLJ21017, GATA zinc finger domain containing 2A, GATA zinc finger domain-containing protein 2A, Hp66alpha, p66 alpha, p66alpha, transcriptional repressor p66-alpha
Gene Symbols GATAD2A
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIP
Molecular Weight of Antigen 68 kDa
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54815
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.