missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p57 Kip2 Rabbit anti-Human, Mouse, Rat, Clone: 6T4E6, Novus Biologicals™
Shop All Bio Techne ProductsDescription
p57 Kip2 Monoclonal antibody specifically detects p57 Kip2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | p57 Kip2 |
| Applications | Western Blot |
| Classification | Monoclonal |
| Clone | 6T4E6 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | Beckwith-Wiedemann syndrome, BWS, cyclin-dependent kinase inhibitor 1C, cyclin-dependent kinase inhibitor 1C (p57, Kip2), Cyclin-dependent kinase inhibitor p57, KIP2BWCR, p57, p57Kip2, WBS |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human p57 Kip2 (P49918). MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?