missing translation for 'onlineSavingsMsg'
Learn More

p57 Kip2 Rabbit anti-Human, Mouse, Rat, Clone: 6T4E6, Novus Biologicals™

Product Code. 18356994 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18356994 100 μg 100µL
18372167 20 μg 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18356994 Supplier Novus Biologicals Supplier No. NBP316648100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Monoclonal Antibody

p57 Kip2 Monoclonal antibody specifically detects p57 Kip2 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen p57 Kip2
Applications Western Blot
Classification Monoclonal
Clone 6T4E6
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias Beckwith-Wiedemann syndrome, BWS, cyclin-dependent kinase inhibitor 1C, cyclin-dependent kinase inhibitor 1C (p57, Kip2), Cyclin-dependent kinase inhibitor p57, KIP2BWCR, p57, p57Kip2, WBS
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human p57 Kip2 (P49918). MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRC
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, Cell Cycle and Replication, Core ESC Like Genes, DNA Repair, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 1028
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.