missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
p53 AIP1 Polyclonal antibody specifically detects p53 AIP1 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | p53 AIP1 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | p53AIP1, p53-regulated apoptosis-inducing protein 1, tumor protein p53 regulated apoptosis inducing protein 1 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human p53 AIP1 (NP_001238893.1).,, Sequence:, MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?