missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p33MONOX Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-56955
This item is not returnable.
View return policy
Description
p33MONOX Polyclonal specifically detects p33MONOX in Human samples. It is validated for Western Blot.
Specifications
| p33MONOX | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Brain-derived rescue factor p60MONOX, FLJ21022, hypothetical protein LOC57179, KIAA1191, p60MONOX | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 57179 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q96A73 | |
| KIAA1191 | |
| Synthetic peptides corresponding to KIAA1191(KIAA1191) The peptide sequence was selected from the middle region of KIAA1191. Peptide sequence TKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWF. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Guinea pig: 78%; Rabbit: 78%. | |
| Human, Rat, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction