missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p33MONOX Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | p33MONOX |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
p33MONOX Polyclonal specifically detects p33MONOX in Human samples. It is validated for Western Blot.Specifications
| p33MONOX | |
| Polyclonal | |
| Rabbit | |
| Q96A73 | |
| 57179 | |
| Synthetic peptides corresponding to KIAA1191(KIAA1191) The peptide sequence was selected from the middle region of KIAA1191. Peptide sequence TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Brain-derived rescue factor p60MONOX, FLJ21022, hypothetical protein LOC57179, KIAA1191, p60MONOX | |
| KIAA1191 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title