missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P311 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-84315
This item is not returnable.
View return policy
Description
P311 Polyclonal antibody specifically detects P311 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications
| chromosome 5 open reading frame 13, neuronal protein 3.1, P311PTZ17D4S114, PRO1873, Protein p311 | |
| Rabbit | |
| Affinity Purified |
| NREP | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:YYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSEL |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction