missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
P2Y4/P2RY4 Polyclonal antibody specifically detects P2Y4/P2RY4 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | P2Y4/P2RY4 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | P2P, P2Y4P2Y purinoceptor 4, pyrimidinergic receptor P2Y, G-protein coupled, 4, UNRNRUUridine nucleotide receptor |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 286-365 of human P2RY4 (NP_002556.1). VVYKVTRPLASANSCLDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTPRADRL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?