missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P2Y10/P2RY10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | P2Y10/P2RY10 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18286194
|
Novus Biologicals
NBP2-56283 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18698118
|
Novus Biologicals
NBP2-56283-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
P2Y10/P2RY10 Polyclonal specifically detects P2Y10/P2RY10 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| P2Y10/P2RY10 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| G-protein coupled purinergic receptor P2Y10, P2Y purinoceptor 10, P2Y10P2Y-like receptor, purinergic receptor P2Y, G-protein coupled, 10, putative P2Y purinoceptor 10 | |
| P2RY10 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cytokine Research, GPCR, Plasma Membrane Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 27334 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MASEFRDQLSRHGSSVTRSRLMSKESGSSMIG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title