P2Y1/P2RY1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Brand:  Novus Biologicals NBP1-69246

Product Code. 18200863

Description

P2Y1/P2RY1 Polyclonal specifically detects P2Y1/P2RY1 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: P2Y1/P2RY1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATP receptor, P2 purinoceptor subtype Y1, P2Y purinoceptor 1, P2Y1platelet ADP receptor, Purinergic receptor, purinergic receptor P2Y, G-protein coupled, 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cytokine Research, Plasma Membrane Markers
• Gene ID (Entrez): 5028
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H244
• Gene Symbols: P2RY1
• Immunogen: Synthetic peptide directed towards the N terminal region of human P2Y1/P2RY1. The peptide sequence was selected from the N terminal of P2Y1/P2RY1 (NP_002554). VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG. The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only