missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P2Y1/P2RY1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-69246
This item is not returnable.
View return policy
Description
P2Y1/P2RY1 Polyclonal specifically detects P2Y1/P2RY1 in Human, Mouse samples. It is validated for Western Blot.
Specifications
| P2Y1/P2RY1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ATP receptor, P2 purinoceptor subtype Y1, P2Y purinoceptor 1, P2Y1platelet ADP receptor, Purinergic receptor, purinergic receptor P2Y, G-protein coupled, 1 | |
| Rabbit | |
| 42 kDa | |
| 100 μL | |
| Apoptosis, Cytokine Research, Plasma Membrane Markers | |
| 5028 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9H244 | |
| P2RY1 | |
| Synthetic peptide directed towards the N terminal region of human P2Y1/P2RY1. The peptide sequence was selected from the N terminal of P2Y1/P2RY1 (NP_002554). VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG. The peptide sequence for this immunogen was taken from within the described region. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction