P2X6/P2RX6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-48583-25ul

Product Code. 18636096

Description

P2X6/P2RX6 Polyclonal antibody specifically detects P2X6/P2RX6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: P2X6/P2RX6
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: ATP receptor, MGC129625, P2RXL1skeletal muscle-expressed P2X, P2X purinoceptor 6, P2X6purinoceptor P2X6, P2XMpurinoreceptor P2X6, Purinergic receptor, purinergic receptor P2X, ligand-gated ion channel, 6, Purinergic receptor P2X-like 1, purinergic receptor P2X-like 1, orphan receptor
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HFYWRTKYEEAKAPKATANSVWRELALASQARLAECLRRSSAPAPTATAAGSQTQTPGWPCPSSDTHLPTHS
• Quantity: 25 μL
• Research Discipline: Cancer, Cardiovascular Biology, Endocrinology, Neuroscience, Signal Transduction
• Gene ID (Entrez): 9127
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified