missing translation for 'onlineSavingsMsg'
Learn More
Learn More
P2X3/P2RX3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33848
This item is not returnable.
View return policy
Description
P2X3/P2RX3 Polyclonal specifically detects P2X3/P2RX3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| P2X3/P2RX3 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| P56373 | |
| P2RX3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKY | |
| 0.1 mL | |
| Signal Transduction | |
| 5024 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ATP receptor, MGC129956, P2X purinoceptor 3, P2X receptor, subunit 3, P2X3purinergic receptor P2X3, Purinergic receptor, purinergic receptor P2X, ligand-gated ion channel, 3, purinoceptor P2X3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction