missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p23/PTGES3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85485-25ul
This item is not returnable.
View return policy
Description
p23/PTGES3 Polyclonal specifically detects p23/PTGES3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| p23/PTGES3 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| cPGESp23, Cytosolic prostaglandin E2 synthase, Hsp90 co-chaperone, P23cytosolic prostaglandin E synthase, Progesterone receptor complex p23, prostaglandin E synthase 3, prostaglandin E synthase 3 (cytosolic), TEBPEC 5.3.99.3, Telomerase-binding protein p23, unactive progesterone receptor, 23 kD | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human p23/PTGES3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PTGES3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:CVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLT | |
| 25 μL | |
| Membrane Trafficking and Chaperones | |
| 10728 | |
| Human, Mouse, Rat | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction