missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18376868

p190RhoGAP Antibody (4D4-F8), Novus Biologicals™

Product Code. 18376868 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18376868 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18376868 Supplier Novus Biologicals Supplier No. H00002909M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

p190RhoGAP Monoclonal antibody specifically detects p190RhoGAP in Human samples. It is validated for ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen p190RhoGAP
Applications ELISA, Sandwich ELISA
Classification Monoclonal
Clone 4D4-F8
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Alias glucocorticoid receptor DNA binding factor 1, glucocorticoid receptor DNA-binding factor 1, glucocorticoid receptor repression factor 1, GRF1, GRF-1, GRLF1, KIAA1722, MGC10745, P190A, P190-A, p190ARhoGAP, p190RhoGAP, rho GAP p190A, Rho GTPase activating protein 35, rho GTPase-activating protein 35
Host Species Mouse
Immunogen GRLF1 (AAH03514, 1 a.a. ~ 36 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 2909
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.