missing translation for 'onlineSavingsMsg'
Learn More
Learn More
p19 INK4d Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | p19 INK4d |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18294495
|
Novus Biologicals
NBP2-58778 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18692517
|
Novus Biologicals
NBP2-58778-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
p19 INK4d Polyclonal specifically detects p19 INK4d in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| p19 INK4d | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Ovarian Carcinoma Cell Markers | |
| CDK inhibitor p19INK4d, cell cycle inhibitor, Nur77 associating protein, cyclin-dependent kinase 4 inhibitor D, cyclin-dependent kinase 4 inhibitor D p19, cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4), inhibitor of cyclin-dependent kinase 4d, INK4D, p19, p19-INK4D | |
| CDKN2D | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 1032 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title