missing translation for 'onlineSavingsMsg'
Learn More

p18INK4c/CDKN2C Antibody, Novus Biologicals™

Product Code. 18407421 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18407421 25 μL 25µL
18465891 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18407421 Supplier Novus Biologicals Supplier No. NBP18768725ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

p18INK4c/CDKN2C Polyclonal antibody specifically detects p18INK4c/CDKN2C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen p18INK4c/CDKN2C
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias CDK6 inhibitor p18, CDKN6, cyclin-dependent inhibitor, cyclin-dependent kinase 4 inhibitor C, Cyclin-dependent kinase 6 inhibitor, cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4), INK4Ccyclin-dependent kinase 6 inhibitor p18, p18, p18-INK4C, p18-INK6
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 1031
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.