missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18340628

p15INK4b/CDKN2B Antibody, Novus Biologicals™

Product Code. 18340628 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
50 μg
Unit Size:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18340628 50 μg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18340628 Supplier Novus Biologicals Supplier No. H00001030B02P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

p15INK4b/CDKN2B Polyclonal antibody specifically detects p15INK4b/CDKN2B in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry
TRUSTED_SUSTAINABILITY

Specifications

Antigen p15INK4b/CDKN2B
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. AAH14469
Gene Alias CDK4I, cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4), cyclin-dependent kinases 4 and 6 binding protein, INK4BCDK4B inhibitor, MTS-2, MTS2CDK inhibitory protein, Multiple tumor suppressor 2, p14_CDK inhibitor, p14_INK4B, p14-INK4b, p15 CDK inhibitor, p15_INK4B, P15cyclin-dependent kinase 4 inhibitor B, p15INK4b, p15-INK4b, TP15
Host Species Mouse
Immunogen CDKN2B (AAH14469, 1 a.a. - 138 a.a.) full-length human protein. MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Purification Method Protein G purified
Quantity 50 μg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 1030
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.