missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OXSR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35502-100ul
This item is not returnable.
View return policy
Description
OXSR1 Polyclonal antibody specifically detects OXSR1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| OXSR1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| EC 2.7.11, EC 2.7.11.1, KIAA1101OSR1serine/threonine-protein kinase OSR1, Oxidative stress-responsive 1 protein, oxidative-stress responsive 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OXSR1 (NP_005100.1).,, Sequence:, MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSV | |
| 100 μL | |
| Protein Kinase | |
| 9943 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction