OXSR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP3-35502-100ul

Codice prodotto. 30232862

Descrizione

OXSR1 Polyclonal antibody specifically detects OXSR1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence

Specifica

• Antigen: OXSR1
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
• Gene Alias: EC 2.7.11, EC 2.7.11.1, KIAA1101OSR1serine/threonine-protein kinase OSR1, Oxidative stress-responsive 1 protein, oxidative-stress responsive 1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OXSR1 (NP_005100.1).,, Sequence:, MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSV
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 9943
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified