missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OVOL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35802-100ul
This item is not returnable.
View return policy
Description
OVOL2 Polyclonal antibody specifically detects OVOL2 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| OVOL2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| bA504H3.3, hOvo2, ovo-like 2 (Drosophila), transcription factor Ovo-like 2, Zinc finger protein 339EUROIMAGE566589, ZNF339 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 24-98 of human OVOL2 (NP_067043.2).,, Sequence:, DEKRADTYIPVGLGRLLHDPPEDCRSDGGSSSGSGSSSAGEPGGAESSSSPHAPESETPEPGDAEGPDGHLATKQ | |
| 100 μL | |
| Primary | |
| Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 58495 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction