OVCA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57765-25ul

Product Code. 18674707

Description

OVCA1 Polyclonal specifically detects OVCA1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: OVCA1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: Diphthamide biosynthesis protein 2 homolog-like 1, Diphthamide biosynthesis protein 2-like, diptheria toxin resistance protein required for diphthamide biosynthesis(Saccharomyces)-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1(S. cerevisiae), DPH1 homolog, DPH1 homolog (S. cerevisiae), DPH2L, DPH2L1diphthamide biosynthesis protein 1, DPH2-like 1, DPH-like 1, DPH-like 1 (S. cerevisiae), FLJ33211, hsDph1, Ovarian cancer-associated gene 1 protein, ovarian tumor suppressor candidate 1, OVCA1candidate tumor suppressor in ovarian cancer 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1801
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: DPH1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAK
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only